PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06793g07010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 297aa    MW: 32010.6 Da    PI: 9.4058
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06793g07010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-3856114361
                    zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               +++++cprCds ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  Niben101Scf06793g07010.1  56 SENIRCPRCDSPNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNT 114
                               57899***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-3258113IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2559112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.26459113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MIRELFAGNT TLMGGGENIS KHSNTPSSSP LSSTSNSSTL TTNIPAPANA SSSSNSENIR  60
CPRCDSPNTK FCYYNNYNLT QPRHFCKTCR RYWTKGGALR NVPIGGGCRK NKNTNISTTS  120
AAKSSAAKLK ASLPSFLGGL EHEISNSNPF LFSSPQNQYP LISILRGNHQ NLSFNADTWH  180
FPISVAVKEE GKSIGMNSYN QLPNSLGFCS NLLKNNQQNG SIIGKVQSSG LQELYQRLQA  240
STSRCYPDHA LSLLGNTASS SSMILESAPV GAGGELSFWN PSISTWSDLQ TANGAYF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016439189.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLM1AMF61e-104M1AMF6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000259841e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-33DOF zinc finger protein 1